BMP6 antibody (Middle Region)

Catalog No. ABIN634774

Product Details anti-BMP6 Antibody

Target: BMP6 (Bone Morphogenetic Protein 6 (BMP6))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BMP6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BMP6 antibody was raised against the middle region of BMP6

Purification: Affinity purified

Immunogen: BMP6 antibody was raised using the middle region of BMP6 corresponding to a region with amino acids MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BMP6 Blocking Peptide, catalog no. 33R-6576, is also available for use as a blocking control in assays to test for specificity of this BMP6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BMP6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BMP6

Target: BMP6 (Bone Morphogenetic Protein 6 (BMP6))

Alternative Name: BMP6 (BMP6 Products)

Synonyms: BMP6 antibody, zgc:113595 antibody, vgr antibody, vgr-1 antibody, vgr1 antibody, VGR antibody, VGR1 antibody, D13Wsu115e antibody, Vgr1 antibody, bone morphogenetic protein 6 antibody, bone morphogenetic protein 6 S homeolog antibody, BMP6 antibody, bmp6 antibody, bmp6.S antibody, Bmp6 antibody

Background: The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process