LONRF2 antibody (Middle Region)

Catalog No. ABIN634772

Product Details anti-LONRF2 Antibody

Target: LONRF2 (LON Peptidase N-terminal Domain and Ring Finger 2 (LONRF2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LONRF2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LONRF2 antibody was raised against the middle region of LONRF2

Purification: Affinity purified

Immunogen: LONRF2 antibody was raised using the middle region of LONRF2 corresponding to a region with amino acids FGMCLSAEHAGLSEYGCMLEIKDVRTFPDGSSVVDAIGISRFRVLSHRHR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LONRF2 Blocking Peptide, catalog no. 33R-2908, is also available for use as a blocking control in assays to test for specificity of this LONRF2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LONRF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LONRF2

Target: LONRF2 (LON Peptidase N-terminal Domain and Ring Finger 2 (LONRF2))

Alternative Name: LONRF2 (LONRF2 Products)

Synonyms: RGD1562137 antibody, AI851349 antibody, 2900060P06Rik antibody, LONRF2 antibody, RNF192 antibody, LON peptidase N-terminal domain and ring finger 2 antibody, Lonrf2 antibody, LONRF2 antibody, lonrf2 antibody

Background: LONRF2 contains 1 Lon domain,1 RING-type zinc finger and 6 TPR repeats. The function of the LONRF2 protein remains unknown.

Molecular Weight: 84 kDa (MW of target protein)