Claudin 19 antibody (C-Term)

Catalog No. ABIN634757

Product Details anti-Claudin 19 Antibody

Target: Claudin 19 (CLDN19)

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Claudin 19 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Claudin 19 antibody was raised against the C terminal of CLDN19

Purification: Affinity purified

Immunogen: Claudin 19 antibody was raised using the C terminal of CLDN19 corresponding to a region with amino acids AVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Claudin 19 Blocking Peptide, catalog no. 33R-1605, is also available for use as a blocking control in assays to test for specificity of this Claudin 19 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Claudin 19

Target: Claudin 19 (CLDN19)

Alternative Name: Claudin 19 (CLDN19 Products)

Synonyms: HOMG5 antibody, claudin-19 antibody, zgc:112141 antibody, claudin 19 antibody, claudin 19 S homeolog antibody, CLDN19 antibody, Cldn19 antibody, cldn19.S antibody, cldn19 antibody

Background: CLDN19 belongs to the claudin family. It plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Defects in this gene are the cause of hypomagnesemia renal with ocular involvement (HOMGO).

Molecular Weight: 23 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C