SIGLEC9 antibody (C-Term)

Catalog No. ABIN634755

Product Details anti-SIGLEC9 Antibody

Target: SIGLEC9 (Sialic Acid Binding Ig-Like Lectin 9 (SIGLEC9))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SIGLEC9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SIGLEC9 antibody was raised against the C terminal of SIGLEC9

Purification: Affinity purified

Immunogen: SIGLEC9 antibody was raised using the C terminal of SIGLEC9 corresponding to a region with amino acids PWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATA

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SIGLEC9 Blocking Peptide, catalog no. 33R-7438, is also available for use as a blocking control in assays to test for specificity of this SIGLEC9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SIGLEC9

Target: SIGLEC9 (Sialic Acid Binding Ig-Like Lectin 9 (SIGLEC9))

Alternative Name: SIGLEC9 (SIGLEC9 Products)

Synonyms: CD329 antibody, CDw329 antibody, FOAP-9 antibody, OBBP-LIKE antibody, siglec-9 antibody, siglec9 antibody, sialic acid binding Ig like lectin 9 antibody, sialic acid-binding immunoglobulin-like lectin 9 antibody, SIGLEC9 antibody

Background: SIGLEC9 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. It preferentially binds to alpha2,3- or 2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.

Molecular Weight: 50 kDa (MW of target protein)