SIGLEC9 antibody (C-Term)
-
- Target See all SIGLEC9 Antibodies
- SIGLEC9 (Sialic Acid Binding Ig-Like Lectin 9 (SIGLEC9))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SIGLEC9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SIGLEC9 antibody was raised against the C terminal of SIGLEC9
- Purification
- Affinity purified
- Immunogen
- SIGLEC9 antibody was raised using the C terminal of SIGLEC9 corresponding to a region with amino acids PWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATA
- Top Product
- Discover our top product SIGLEC9 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SIGLEC9 Blocking Peptide, catalog no. 33R-7438, is also available for use as a blocking control in assays to test for specificity of this SIGLEC9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SIGLEC9 (Sialic Acid Binding Ig-Like Lectin 9 (SIGLEC9))
- Alternative Name
- SIGLEC9 (SIGLEC9 Products)
- Background
- SIGLEC9 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. It preferentially binds to alpha2,3- or 2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.
- Molecular Weight
- 50 kDa (MW of target protein)
-