LYVE1 antibody (N-Term)
-
- Target See all LYVE1 Antibodies
- LYVE1 (Lymphatic Vessel Endothelial Hyaluronan Receptor 1 (LYVE1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LYVE1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LYVE1 antibody was raised against the N terminal of LYVE1
- Purification
- Affinity purified
- Immunogen
- LYVE1 antibody was raised using the N terminal of LYVE1 corresponding to a region with amino acids ARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQ
- Top Product
- Discover our top product LYVE1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LYVE1 Blocking Peptide, catalog no. 33R-1461, is also available for use as a blocking control in assays to test for specificity of this LYVE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYVE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
Identification of lymphatics in the ciliary body of the human eye: a novel "uveolymphatic" outflow pathway." in: Experimental eye research, Vol. 89, Issue 5, pp. 810-9, (2009) (PubMed).
: "
-
Identification of lymphatics in the ciliary body of the human eye: a novel "uveolymphatic" outflow pathway." in: Experimental eye research, Vol. 89, Issue 5, pp. 810-9, (2009) (PubMed).
-
- Target
- LYVE1 (Lymphatic Vessel Endothelial Hyaluronan Receptor 1 (LYVE1))
- Alternative Name
- LYVE1 (LYVE1 Products)
- Synonyms
- LYVE1 antibody, XLKD1 antibody, CRSBP-1 antibody, HAR antibody, LYVE-1 antibody, 1200012G08Rik antibody, Crsbp-1 antibody, Lyve-1 antibody, Xlkd1 antibody, lymphatic vessel endothelial hyaluronic receptor 1a antibody, lymphatic vessel endothelial hyaluronan receptor 1 antibody, lyve1a antibody, LYVE1 antibody, Lyve1 antibody
- Background
- LYVE1 is a type I integral membrane glycoprotein. It acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis.
- Molecular Weight
- 35 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-