Protocadherin 8 antibody (Middle Region)

Catalog No. ABIN634753

Product Details anti-Protocadherin 8 Antibody

Target: Protocadherin 8 (PCDH8)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Protocadherin 8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCDH8 antibody was raised against the middle region of PCDH8

Purification: Affinity purified

Immunogen: PCDH8 antibody was raised using the middle region of PCDH8 corresponding to a region with amino acids GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCDH8 Blocking Peptide, catalog no. 33R-3177, is also available for use as a blocking control in assays to test for specificity of this PCDH8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Protocadherin 8

Target: Protocadherin 8 (PCDH8)

Alternative Name: PCDH8 (PCDH8 Products)

Synonyms: papc antibody, xpapc antibody, protocadherin-8 antibody, ARCADLIN antibody, PAPC antibody, 1700080P15Rik antibody, Papc antibody, Arcadlin antibody, protocadherin 8 antibody, protocadherin 8 L homeolog antibody, protocadherin-8 antibody, PCDH8 antibody, pcdh8.L antibody, LOC485469 antibody, Pcdh8 antibody, LOC100155738 antibody

Background: This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. PCDH8 is an integral membrane protein that is thought to function in cell adhesion in a CNS-specific manner. Unlike classical cadherins, which are generally encoded by 15-17 exons, this gene includes only 3 exons. Notable is the large first exon encoding the extracellular region, including 6 cadherin domains and a transmembrane region.

Molecular Weight: 101 kDa (MW of target protein)