Protocadherin 8 antibody (Middle Region)
-
- Target See all Protocadherin 8 (PCDH8) Antibodies
- Protocadherin 8 (PCDH8)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Protocadherin 8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PCDH8 antibody was raised against the middle region of PCDH8
- Purification
- Affinity purified
- Immunogen
- PCDH8 antibody was raised using the middle region of PCDH8 corresponding to a region with amino acids GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG
- Top Product
- Discover our top product PCDH8 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PCDH8 Blocking Peptide, catalog no. 33R-3177, is also available for use as a blocking control in assays to test for specificity of this PCDH8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Protocadherin 8 (PCDH8)
- Alternative Name
- PCDH8 (PCDH8 Products)
- Background
- This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. PCDH8 is an integral membrane protein that is thought to function in cell adhesion in a CNS-specific manner. Unlike classical cadherins, which are generally encoded by 15-17 exons, this gene includes only 3 exons. Notable is the large first exon encoding the extracellular region, including 6 cadherin domains and a transmembrane region.
- Molecular Weight
- 101 kDa (MW of target protein)
-