Cadherin 7 antibody (N-Term)
-
- Target See all Cadherin 7 (CDH7) Antibodies
- Cadherin 7 (CDH7)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Cadherin 7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CDH7 antibody was raised against the N terminal of CDH7
- Purification
- Affinity purified
- Immunogen
- CDH7 antibody was raised using the N terminal of CDH7 corresponding to a region with amino acids PKFLDGPYTAGVPEMSPVGTSVVQVTATDADDPTYGNSARVVYSILQGQP
- Top Product
- Discover our top product CDH7 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CDH7 Blocking Peptide, catalog no. 33R-7167, is also available for use as a blocking control in assays to test for specificity of this CDH7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cadherin 7 (CDH7)
- Alternative Name
- CDH7 (CDH7 Products)
- Background
- CDH7 is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. Cadherins mediate cell-cell binding in a homophilic manner, contributing to the sorting of heterogeneous cell types and the maintenance of orderly structures.
- Molecular Weight
- 82 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-