Cadherin 7 antibody (N-Term)

Catalog No. ABIN634751

Product Details anti-Cadherin 7 Antibody

Target: Cadherin 7 (CDH7)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cadherin 7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CDH7 antibody was raised against the N terminal of CDH7

Purification: Affinity purified

Immunogen: CDH7 antibody was raised using the N terminal of CDH7 corresponding to a region with amino acids PKFLDGPYTAGVPEMSPVGTSVVQVTATDADDPTYGNSARVVYSILQGQP

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDH7 Blocking Peptide, catalog no. 33R-7167, is also available for use as a blocking control in assays to test for specificity of this CDH7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cadherin 7

Target: Cadherin 7 (CDH7)

Alternative Name: CDH7 (CDH7 Products)

Synonyms: CDH7L1 antibody, Cad7 antibody, 9330156F07Rik antibody, cadherin 7 antibody, cadherin 7, type 2 antibody, cadherin 7a antibody, CDH7 antibody, Cdh7 antibody, cdh7a antibody

Background: CDH7 is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. Cadherins mediate cell-cell binding in a homophilic manner, contributing to the sorting of heterogeneous cell types and the maintenance of orderly structures.

Molecular Weight: 82 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization