ITGB8 antibody (C-Term)

Catalog No. ABIN634750

Product Details anti-ITGB8 Antibody

Target: ITGB8 (Integrin beta-8 (ITGB8))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ITGB8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Integrin Beta 8 antibody was raised against the C terminal of ITGB8

Purification: Affinity purified

Immunogen: Integrin Beta 8 antibody was raised using the C terminal of ITGB8 corresponding to a region with amino acids CTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Integrin Beta 8 Blocking Peptide, catalog no. 33R-1821, is also available for use as a blocking control in assays to test for specificity of this Integrin Beta 8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ITGB8

Target: ITGB8 (Integrin beta-8 (ITGB8))

Alternative Name: Integrin beta 8 (ITGB8 Products)

Synonyms: 4832412O06Rik antibody, integrin beta 8 antibody, integrin subunit beta 8 antibody, Itgb8 antibody, ITGB8 antibody

Background: ITGB8 is a member of the integrin beta chain family and is a single-pass type I membrane protein with a VWFA domain and four cysteine-rich repeats. This protein noncovalently binds to an alpha subunit to form a heterodimeric integrin complex. In general, integrin complexes mediate cell-cell and cell-extracellular matrix interactions and this complex plays a role in human airway epithelial proliferation.

Molecular Weight: 81 kDa (MW of target protein)