GJC2 antibody (Middle Region)
-
- Target See all GJC2 Antibodies
- GJC2 (Gap Junction Protein, gamma 2, 47kDa (GJC2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GJC2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GJC2 antibody was raised against the middle region of GJC2
- Purification
- Affinity purified
- Immunogen
- GJC2 antibody was raised using the middle region of GJC2 corresponding to a region with amino acids APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW
- Top Product
- Discover our top product GJC2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GJC2 Blocking Peptide, catalog no. 33R-1416, is also available for use as a blocking control in assays to test for specificity of this GJC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GJC2 (Gap Junction Protein, gamma 2, 47kDa (GJC2))
- Alternative Name
- GJC2 (GJC2 Products)
- Synonyms
- GJA12 antibody, cx47 antibody, gja12 antibody, cx46.6 antibody, pmldar antibody, MGC146420 antibody, B230382L12Rik antibody, Cx47 antibody, Gja12 antibody, CX46.6 antibody, HLD2 antibody, LMPH1C antibody, PMLDAR antibody, SPG44 antibody, gap junction protein gamma 2 antibody, si:dkey-91f15.1 antibody, gap junction protein, gamma 2 antibody, GJC2 antibody, gjc2 antibody, si:dkey-91f15.1 antibody, Gjc2 antibody
- Background
- GJC2 is a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains. This gene plays a key role in central myelination and is involved in peripheral myelination in humans.
- Molecular Weight
- 47 kDa (MW of target protein)
-