PCDHA6 antibody (C-Term)

Catalog No. ABIN634742

Product Details anti-PCDHA6 Antibody

Target: PCDHA6 (Protocadherin alpha 6 (PCDHA6))

Binding Specificity: C-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCDHA6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCDHA6 antibody was raised against the C terminal of PCDHA6

Purification: Affinity purified

Immunogen: PCDHA6 antibody was raised using the C terminal of PCDHA6 corresponding to a region with amino acids LVKDHGEPALTATATVLVSLVESGQAPKASSRASVGAAGPEAALVDVNVY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCDHA6 Blocking Peptide, catalog no. 33R-5518, is also available for use as a blocking control in assays to test for specificity of this PCDHA6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCDHA6

Target: PCDHA6 (Protocadherin alpha 6 (PCDHA6))

Alternative Name: PCDHA6 (PCDHA6 Products)

Synonyms: CNR2 antibody, CNRN2 antibody, CNRS2 antibody, CRNR2 antibody, PCDH-ALPHA6 antibody, CNR antibody, Cnr2 antibody, Crnr2 antibody, rCNRv06 antibody, PCDHA3 antibody, PCDHA6 antibody, PCDHA7 antibody, PCDHA9 antibody, protocadherin alpha 6 antibody, PCDHA6 antibody, Pcdha6 antibody

Background: PCDHA6 contains 6 cadherin domains. It is a potential calcium-dependent cell-adhesion protein. PCDHA6 may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Molecular Weight: 84 kDa (MW of target protein)