PCDHA6 antibody (C-Term)
-
- Target See all PCDHA6 Antibodies
- PCDHA6 (Protocadherin alpha 6 (PCDHA6))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PCDHA6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PCDHA6 antibody was raised against the C terminal of PCDHA6
- Purification
- Affinity purified
- Immunogen
- PCDHA6 antibody was raised using the C terminal of PCDHA6 corresponding to a region with amino acids LVKDHGEPALTATATVLVSLVESGQAPKASSRASVGAAGPEAALVDVNVY
- Top Product
- Discover our top product PCDHA6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PCDHA6 Blocking Peptide, catalog no. 33R-5518, is also available for use as a blocking control in assays to test for specificity of this PCDHA6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCDHA6 (Protocadherin alpha 6 (PCDHA6))
- Alternative Name
- PCDHA6 (PCDHA6 Products)
- Background
- PCDHA6 contains 6 cadherin domains. It is a potential calcium-dependent cell-adhesion protein. PCDHA6 may be involved in the establishment and maintenance of specific neuronal connections in the brain.
- Molecular Weight
- 84 kDa (MW of target protein)
-