PCDHA5 antibody (N-Term)

Catalog No. ABIN634740

Product Details anti-PCDHA5 Antibody

Target: PCDHA5 (Protocadherin alpha 5 (PCDHA5))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCDHA5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCDHA5 antibody was raised against the N terminal of PCDHA5

Purification: Affinity purified

Immunogen: PCDHA5 antibody was raised using the N terminal of PCDHA5 corresponding to a region with amino acids VYSRRGSLGSRLLLLWLLLAYWKAGSGQLHYSIPEEAKHGTFVGRIAQDL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCDHA5 Blocking Peptide, catalog no. 33R-9928, is also available for use as a blocking control in assays to test for specificity of this PCDHA5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCDHA5

Target: PCDHA5 (Protocadherin alpha 5 (PCDHA5))

Alternative Name: PCDHA5 (PCDHA5 Products)

Synonyms: CNR6 antibody, CNRN6 antibody, CNRS6 antibody, CRNR6 antibody, PCDH-ALPHA5 antibody, Cnr6 antibody, Crnr6 antibody, rCNRv05 antibody, PCDHA5 antibody, Pcdha5 antibody, protocadherin alpha 5 antibody, protocadherin alpha-5 antibody, PCDHA5 antibody, Pcdha5 antibody, LOC100738784 antibody, LOC100847156 antibody, LOC100713870 antibody, LOC100629824 antibody

Background: The gene encoding PCDHA5 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. PCDHA5 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHA5 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Molecular Weight: 99 kDa (MW of target protein)