PCDHA4 antibody (C-Term)

Catalog No. ABIN634737

Product Details anti-PCDHA4 Antibody

Target: PCDHA4 (Protocadherin alpha 4 (PCDHA4))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCDHA4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCDHA4 antibody was raised against the C terminal of PCDHA4

Purification: Affinity purified

Immunogen: PCDHA4 antibody was raised using the C terminal of PCDHA4 corresponding to a region with amino acids SGYNAWLSYELQPETASASIPFRVGLYTGEISTTRALDETDAPRQRLLVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCDHA4 Blocking Peptide, catalog no. 33R-8505, is also available for use as a blocking control in assays to test for specificity of this PCDHA4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCDHA4

Target: PCDHA4 (Protocadherin alpha 4 (PCDHA4))

Alternative Name: PCDHA4 (PCDHA4 Products)

Synonyms: CNR1 antibody, CNRN1 antibody, CRNR1 antibody, PCDH-ALPHA4 antibody, Cnr1 antibody, Crnr1 antibody, R75250 antibody, PCDHA4 antibody, CNRv4 antibody, Pcdha4 antibody, protocadherin alpha 4 antibody, protocadherin alpha-4 antibody, PCDHA4 antibody, Pcdha4 antibody, LOC100713594 antibody, LOC100629843 antibody

Background: The gene encoding PCDHA4 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. PCDHA4 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHA4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Molecular Weight: 99 kDa (MW of target protein)