Neuroligin 4 antibody (N-Term)

Catalog No. ABIN634735

Product Details anti-Neuroligin 4 Antibody

Target: Neuroligin 4 (NLGN4)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Neuroligin 4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NLGN4 X antibody was raised against the N terminal of NLGN4

Purification: Affinity purified

Immunogen: NLGN4 X antibody was raised using the N terminal of NLGN4 corresponding to a region with amino acids SILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEEN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NLGN4X Blocking Peptide, catalog no. 33R-8532, is also available for use as a blocking control in assays to test for specificity of this NLGN4X antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NLGN0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Neuroligin 4

Target: Neuroligin 4 (NLGN4)

Alternative Name: NLGN4X (NLGN4 Products)

Background: NLGN4X is a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. It interacts with discs, large (Drosophila) homolog 4 (DLG4). NLGN4X might play a role in the autism and Asperger syndrome.

Molecular Weight: 92 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Synaptic Membrane