GJD2 antibody (Middle Region)
-
- Target See all GJD2 Antibodies
- GJD2 (Gap Junction Protein, delta 2, 36kDa (GJD2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GJD2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GJD2 antibody was raised against the middle region of GJD2
- Purification
- Affinity purified
- Immunogen
- GJD2 antibody was raised using the middle region of GJD2 corresponding to a region with amino acids ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY
- Top Product
- Discover our top product GJD2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GJD2 Blocking Peptide, catalog no. 33R-2564, is also available for use as a blocking control in assays to test for specificity of this GJD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GJD2 (Gap Junction Protein, delta 2, 36kDa (GJD2))
- Alternative Name
- GJD2 (GJD2 Products)
- Background
- GJD2 is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons.
- Molecular Weight
- 36 kDa (MW of target protein)
-