CNTNAP1 antibody (N-Term)

Catalog No. ABIN634731

Product Details anti-CNTNAP1 Antibody

Target: CNTNAP1 (Contactin Associated Protein 1 (CNTNAP1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CNTNAP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CNTNAP1 antibody was raised against the N terminal of CNTNAP1

Purification: Affinity purified

Immunogen: CNTNAP1 antibody was raised using the N terminal of CNTNAP1 corresponding to a region with amino acids LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CNTNAP1 Blocking Peptide, catalog no. 33R-5315, is also available for use as a blocking control in assays to test for specificity of this CNTNAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNTNAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CNTNAP1

Target: CNTNAP1 (Contactin Associated Protein 1 (CNTNAP1))

Alternative Name: CNTNAP1 (CNTNAP1 Products)

Synonyms: CNTNAP1 antibody, CASPR antibody, CNTNAP antibody, NRXN4 antibody, P190 antibody, Caspr antibody, AI841080 antibody, NCP1 antibody, Nrxn4 antibody, p190 antibody, shm antibody, contactin associated protein 1 antibody, contactin associated protein-like 1 antibody, CNTNAP1 antibody, cntnap1 antibody, Cntnap1 antibody

Background: CNTNAP1 was initially identified as a 190 kDa protein associated with the contactin-PTPRZ1 complex. The 1,384-amino acid protein, also designated p190 or CASPR for 'contactin-associated protein,' includes an extracellular domain with several putative protein-protein interaction domains, a putative transmembrane domain, and a 74-amino acid cytoplasmic domain.

Molecular Weight: 156 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization