CNTNAP1 antibody (N-Term)
-
- Target See all CNTNAP1 Antibodies
- CNTNAP1 (Contactin Associated Protein 1 (CNTNAP1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CNTNAP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CNTNAP1 antibody was raised against the N terminal of CNTNAP1
- Purification
- Affinity purified
- Immunogen
- CNTNAP1 antibody was raised using the N terminal of CNTNAP1 corresponding to a region with amino acids LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNS
- Top Product
- Discover our top product CNTNAP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CNTNAP1 Blocking Peptide, catalog no. 33R-5315, is also available for use as a blocking control in assays to test for specificity of this CNTNAP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNTNAP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CNTNAP1 (Contactin Associated Protein 1 (CNTNAP1))
- Alternative Name
- CNTNAP1 (CNTNAP1 Products)
- Background
- CNTNAP1 was initially identified as a 190 kDa protein associated with the contactin-PTPRZ1 complex. The 1,384-amino acid protein, also designated p190 or CASPR for 'contactin-associated protein,' includes an extracellular domain with several putative protein-protein interaction domains, a putative transmembrane domain, and a 74-amino acid cytoplasmic domain.
- Molecular Weight
- 156 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-