Claudin 7 antibody (Middle Region)

Catalog No. ABIN634729

Product Details anti-Claudin 7 Antibody

Target: Claudin 7 (CLDN7)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Claudin 7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Claudin 7 antibody was raised against the middle region of CLDN7

Purification: Affinity purified

Immunogen: Claudin 7 antibody was raised using the middle region of CLDN7 corresponding to a region with amino acids GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Claudin 7 Blocking Peptide, catalog no. 33R-3466, is also available for use as a blocking control in assays to test for specificity of this Claudin 7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Claudin 7

Target: Claudin 7 (CLDN7)

Alternative Name: Claudin 7 (CLDN7 Products)

Synonyms: cb388 antibody, claudin7 antibody, cldn7 antibody, wu:fd19f08 antibody, MGC53400 antibody, MGC75689 antibody, CLDN7 antibody, CEPTRL2 antibody, CLDN-7 antibody, CPETRL2 antibody, Hs.84359 antibody, claudin-1 antibody, claudin 7b antibody, claudin 7 L homeolog antibody, claudin 7 antibody, cldn7b antibody, cldn7.L antibody, cldn7 antibody, CLDN7 antibody, Cldn7 antibody

Background: Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: Hepatitis C