SIGLEC12 antibody (N-Term)

Catalog No. ABIN634721

Product Details anti-SIGLEC12 Antibody

Target: SIGLEC12 (Sialic Acid Binding Ig-Like Lectin 12 (SIGLEC12))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SIGLEC12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SIGLEC12 antibody was raised against the N terminal of SIGLEC12

Purification: Affinity purified

Immunogen: SIGLEC12 antibody was raised using the N terminal of SIGLEC12 corresponding to a region with amino acids DTRESDAGTYVFCVERGNMKWNYKYDQLSVNVTASQDLLSRYRLEVPESV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SIGLEC12 Blocking Peptide, catalog no. 33R-2208, is also available for use as a blocking control in assays to test for specificity of this SIGLEC12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SIGLEC12

Target: SIGLEC12 (Sialic Acid Binding Ig-Like Lectin 12 (SIGLEC12))

Alternative Name: SIGLEC12 (SIGLEC12 Products)

Synonyms: S2V antibody, SIGLECL1 antibody, SLG antibody, Siglec-XII antibody, sialic acid binding Ig like lectin 12 (gene/pseudogene) antibody, sialic acid binding Ig like lectin 12 antibody, sialic acid binding Ig-like lectin 12 antibody, SIGLEC12 antibody

Background: Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. SIGLEC12 is a member of the SIGLEC3-like subfamily of SIGLECs. SIGLEC12, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2.

Molecular Weight: 63 kDa (MW of target protein)