CNTNAP3 antibody (Middle Region)
-
- Target See all CNTNAP3 Antibodies
- CNTNAP3 (Contactin Associated Protein-Like 3 (CNTNAP3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CNTNAP3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CNTNAP3 antibody was raised against the middle region of CNTNAP3
- Purification
- Affinity purified
- Immunogen
- CNTNAP3 antibody was raised using the middle region of CNTNAP3 corresponding to a region with amino acids GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA
- Top Product
- Discover our top product CNTNAP3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CNTNAP3 Blocking Peptide, catalog no. 33R-3563, is also available for use as a blocking control in assays to test for specificity of this CNTNAP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNTNAP3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CNTNAP3 (Contactin Associated Protein-Like 3 (CNTNAP3))
- Alternative Name
- CNTNAP3 (CNTNAP3 Products)
- Background
- The protein encoded by this gene belongs to the NCP family of cell-recognition molecules. This family represents a distinct subgroup of the neurexins. NCP proteins mediate neuron-glial interactions in vertebrates and glial-glial contact in invertebrates.
- Molecular Weight
- 141 kDa (MW of target protein)
-