CNTNAP3 antibody (Middle Region)

Catalog No. ABIN634718

Product Details anti-CNTNAP3 Antibody

Target: CNTNAP3 (Contactin Associated Protein-Like 3 (CNTNAP3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CNTNAP3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CNTNAP3 antibody was raised against the middle region of CNTNAP3

Purification: Affinity purified

Immunogen: CNTNAP3 antibody was raised using the middle region of CNTNAP3 corresponding to a region with amino acids GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CNTNAP3 Blocking Peptide, catalog no. 33R-3563, is also available for use as a blocking control in assays to test for specificity of this CNTNAP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNTNAP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CNTNAP3

Target: CNTNAP3 (Contactin Associated Protein-Like 3 (CNTNAP3))

Alternative Name: CNTNAP3 (CNTNAP3 Products)

Synonyms: CNTNAP3 antibody, CASPR3 antibody, CNTNAP3A antibody, RP11-138L21.1 antibody, RP11-290L7.1 antibody, Cntnap3b antibody, LRRGT00090 antibody, RGD1563615 antibody, Cntnap3 antibody, contactin-associated protein-like 3 antibody, contactin associated protein like 3 antibody, contactin associated protein-like 3 antibody, LOC609770 antibody, CNTNAP3 antibody, LOC100439741 antibody, LOC100473014 antibody, LOC473240 antibody, LOC100345243 antibody, Cntnap3 antibody, LOC100725022 antibody

Background: The protein encoded by this gene belongs to the NCP family of cell-recognition molecules. This family represents a distinct subgroup of the neurexins. NCP proteins mediate neuron-glial interactions in vertebrates and glial-glial contact in invertebrates.

Molecular Weight: 141 kDa (MW of target protein)