Claudin 11 antibody

Catalog No. ABIN634717

Product Details anti-Claudin 11 Antibody

Target: Claudin 11 (CLDN11)

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Claudin 11 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: Claudin 11 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Claudin 11 Blocking Peptide, catalog no. 33R-9803, is also available for use as a blocking control in assays to test for specificity of this Claudin 11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Claudin 11

Target: Claudin 11 (CLDN11)

Alternative Name: Claudin 11 (CLDN11 Products)

Synonyms: cldn11 antibody, fb97c11 antibody, wu:fb97c11 antibody, claudin-11 antibody, CLDN11 antibody, Claudin-11 antibody, DKFZp459H2322 antibody, OSP antibody, OTM antibody, Claudin11 antibody, Osp antibody, Otm antibody, claudin 11b antibody, claudin 11 antibody, cldn11b antibody, CLDN11 antibody, Cldn11 antibody

Background: CLDN11 belongs to the claudin family of tight junction associated proteins and is a major component of central nervous system myelin that is necessary for normal CNS function. There is growing evidence that the protein determines the permeability between layers of myelin sheaths via focal adhesion and, with its expression highly regulated during development, may play an important role in cellular proliferation and migration. In addition, the protein is a candidate autoantigen in the development of autoimmune demyelinating disease.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: Hepatitis C