ICAM5 antibody (N-Term)
-
- Target See all ICAM5 Antibodies
- ICAM5 (Intercellular Adhesion Molecule 5 (ICAM5))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ICAM5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ICAM5 antibody was raised against the N terminal of ICAM5
- Purification
- Affinity purified
- Immunogen
- ICAM5 antibody was raised using the N terminal of ICAM5 corresponding to a region with amino acids RRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRPD
- Top Product
- Discover our top product ICAM5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ICAM5 Blocking Peptide, catalog no. 33R-8151, is also available for use as a blocking control in assays to test for specificity of this ICAM5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ICAM5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ICAM5 (Intercellular Adhesion Molecule 5 (ICAM5))
- Alternative Name
- ICAM5 (ICAM5 Products)
- Synonyms
- TLCN antibody, TLN antibody, CD50 antibody, ICAM-3 antibody, Icam3 antibody, Tlcn antibody, ICAM5 antibody, icam5 antibody, tlcn antibody, tln antibody, intercellular adhesion molecule 5 antibody, intercellular adhesion molecule 5, telencephalin antibody, intercellular adhesion molecule 5 L homeolog antibody, ICAM5 antibody, Icam5 antibody, LOC100511183 antibody, icam5.L antibody
- Background
- ICAM5 is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein is expressed on the surface of telencephalic neurons and displays two types of adhesion activity, homophilic binding between neurons and heterophilic binding between neurons and leukocytes.
- Molecular Weight
- 95 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, ER-Nucleus Signaling, Maintenance of Protein Location
-