Protocadherin gamma Subfamily C, 3 (PCDHGC3) (N-Term) antibody
-
- Target See all Protocadherin gamma Subfamily C, 3 (PCDHGC3) Antibodies
- Protocadherin gamma Subfamily C, 3 (PCDHGC3)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PCDHGC3 antibody was raised against the N terminal of PCDHGC3
- Purification
- Affinity purified
- Immunogen
- PCDHGC3 antibody was raised using the N terminal of PCDHGC3 corresponding to a region with amino acids ISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYFALRVQTREDSTKY
- Top Product
- Discover our top product PCDHGC3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PCDHGC3 Blocking Peptide, catalog no. 33R-4148, is also available for use as a blocking control in assays to test for specificity of this PCDHGC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHGC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Protocadherin gamma Subfamily C, 3 (PCDHGC3)
- Alternative Name
- PCDHGC3 (PCDHGC3 Products)
- Background
- This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. PCDHGC3 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.
- Molecular Weight
- 91 kDa (MW of target protein)
-