MPZL2 antibody (N-Term)

Catalog No. ABIN634708

Product Details anti-MPZL2 Antibody

Target: MPZL2 (Myelin Protein Zero-Like 2 (MPZL2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MPZL2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MPZL2 antibody was raised against the N terminal of MPZL2

Purification: Affinity purified

Immunogen: MPZL2 antibody was raised using the N terminal of MPZL2 corresponding to a region with amino acids LEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MPZL2 Blocking Peptide, catalog no. 33R-4881, is also available for use as a blocking control in assays to test for specificity of this MPZL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPZL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MPZL2

Target: MPZL2 (Myelin Protein Zero-Like 2 (MPZL2))

Alternative Name: MPZL2 (MPZL2 Products)

Synonyms: cb837 antibody, eva1 antibody, mpzl2 antibody, wu:fb07b02 antibody, EVA1 antibody, EVA antibody, Eva antibody, Eva1 antibody, myelin protein zero-like 2b antibody, myelin protein zero like 2 antibody, myelin protein zero-like 2 antibody, mpzl2b antibody, MPZL2 antibody, Mpzl2 antibody

Background: Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. This gene is expressed in the thymus and in several epithelial structures early in embryogenesis.

Molecular Weight: 22 kDa (MW of target protein)