Cadherin 12 antibody

Catalog No. ABIN634703

Product Details anti-Cadherin 12 Antibody

Target: Cadherin 12

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cadherin 12 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CDH12 antibody was raised using a synthetic peptide corresponding to a region with amino acids DTQEGVIKLKKPLDFETKKAYTFKVEASNLHLDHRFHSAGPFKDTATVKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDH12 Blocking Peptide, catalog no. 33R-2203, is also available for use as a blocking control in assays to test for specificity of this CDH12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cadherin 12

Target: Cadherin 12

Alternative Name: CDH12 (Cadherin 12 Products)

Synonyms: CDHB antibody, Cdhb antibody, RGD1566350 antibody, cdh12 antibody, cadherin 12 antibody, cadherin-12 antibody, CDH12 antibody, Cdh12 antibody, LOC570372 antibody

Background: CDH12 belongs to the protocadherin protein family, a subfamily of the cadherin superfamily. It consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of the classical cadherins. The function of this cellular adhesion protein is undetermined but mouse protocadherin 12 does not bind catenins and appears to have no affect on cell migration or growth.

Molecular Weight: 82 kDa (MW of target protein)