CNTNAP4 antibody (N-Term)

Catalog No. ABIN634701

Product Details anti-CNTNAP4 Antibody

Target: CNTNAP4 (Contactin Associated Protein-Like 4 (CNTNAP4))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CNTNAP4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CNTNAP4 antibody was raised against the N terminal of CNTNAP4

Purification: Affinity purified

Immunogen: CNTNAP4 antibody was raised using the N terminal of CNTNAP4 corresponding to a region with amino acids KLPSTSTLVNLTLGSLLDDQHWHSVLIQRLGKQVNFTVDEHRHHFHARGE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CNTNAP4 Blocking Peptide, catalog no. 33R-4529, is also available for use as a blocking control in assays to test for specificity of this CNTNAP4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNTNAP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CNTNAP4

Target: CNTNAP4 (Contactin Associated Protein-Like 4 (CNTNAP4))

Alternative Name: CNTNAP4 (CNTNAP4 Products)

Synonyms: CNTNAP4 antibody, CNTNAP5 antibody, cntnap4 antibody, CASPR4 antibody, Caspr4 antibody, E130114F09Rik antibody, contactin associated protein like 4 antibody, contactin-associated protein-like 3 antibody, contactin-associated protein-like 4 antibody, contactin associated protein like 3 antibody, contactin associated protein-like 4 antibody, CNTNAP4 antibody, LOC100064076 antibody, LOC100472293 antibody, cntnap3 antibody, cntnap4 antibody, Cntnap4 antibody

Background: CNTNAP4 belongs to the neurexin family, members of which function in the vertebrate nervous system as cell adhesion molecules and receptors. This protein, like other neurexin proteins, contains epidermal growth factor repeats and laminin G domains. In addition, it includes an F5/8 type C domain, discoidin/neuropilin- and fibrinogen-like domains, and thrombospondin N-terminal-like domains.

Molecular Weight: 145 kDa (MW of target protein)