CSGALNACT1 antibody (N-Term)
-
- Target See all CSGALNACT1 Antibodies
- CSGALNACT1 (Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1 (CSGALNACT1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CSGALNACT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CSGALNACT1 antibody was raised against the N terminal Of Csgalnact1
- Purification
- Affinity purified
- Immunogen
- CSGALNACT1 antibody was raised using the N terminal Of Csgalnact1 corresponding to a region with amino acids KAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDE
- Top Product
- Discover our top product CSGALNACT1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CSGALNACT1 Blocking Peptide, catalog no. 33R-4236, is also available for use as a blocking control in assays to test for specificity of this CSGALNACT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSGALNACT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CSGALNACT1 (Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1 (CSGALNACT1))
- Alternative Name
- CSGALNACT1 (CSGALNACT1 Products)
- Background
- CSGALNACT1 is a transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). It is required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains.
- Molecular Weight
- 61 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-