PCDHAC2 antibody (N-Term)

Catalog No. ABIN634694

Product Details anti-PCDHAC2 Antibody

Target: PCDHAC2 (Protocadherin alpha Subfamily C, 2 (PCDHAC2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCDHAC2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCDHAC2 antibody was raised against the N terminal of PCDHAC2

Purification: Affinity purified

Immunogen: PCDHAC2 antibody was raised using the N terminal of PCDHAC2 corresponding to a region with amino acids SPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCDHAC2 Blocking Peptide, catalog no. 33R-8663, is also available for use as a blocking control in assays to test for specificity of this PCDHAC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHAC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCDHAC2

Target: PCDHAC2 (Protocadherin alpha Subfamily C, 2 (PCDHAC2))

Alternative Name: PCDHAC2 (PCDHAC2 Products)

Synonyms: PCDH-ALPHA-C2 antibody, CNRc2 antibody, rCNRvc2 antibody, CNRC02 antibody, PCHD antibody, protocadherin alpha subfamily C, 2 antibody, PCDHAC2 antibody, Pcdhac2 antibody, pcdhac2 antibody

Background: PCDHAC2 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Molecular Weight: 105 kDa (MW of target protein)