PCDHAC1 antibody (N-Term)

Catalog No. ABIN634693

Product Details anti-PCDHAC1 Antibody

Target: PCDHAC1 (Protocadherin alpha Subfamily C, 1 (PCDHAC1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCDHAC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCDHAC1 antibody was raised against the N terminal of PCDHAC1

Purification: Affinity purified

Immunogen: PCDHAC1 antibody was raised using the N terminal of PCDHAC1 corresponding to a region with amino acids RVQALDPDEGSNGEVQYSLSNSTQAELRHRFHVHPKSGEVQVAASLGPPE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCDHAC1 Blocking Peptide, catalog no. 33R-8254, is also available for use as a blocking control in assays to test for specificity of this PCDHAC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHAC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCDHAC1

Target: PCDHAC1 (Protocadherin alpha Subfamily C, 1 (PCDHAC1))

Alternative Name: PCDHAC1 (PCDHAC1 Products)

Synonyms: PCDH-ALPHA-C1 antibody, CNRc1 antibody, rCNRvc1 antibody, protocadherin alpha subfamily C, 1 antibody, PCDHAC1 antibody, Pcdhac1 antibody

Background: PCDHAC1 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters.

Molecular Weight: 87 kDa (MW of target protein)