LSAMP antibody (N-Term)

Catalog No. ABIN634691

Product Details anti-LSAMP Antibody

Target: LSAMP (Limbic System-Associated Membrane Protein (LSAMP))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LSAMP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LSAMP antibody was raised against the N terminal of LSAMP

Purification: Affinity purified

Immunogen: LSAMP antibody was raised using the N terminal of LSAMP corresponding to a region with amino acids MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LSAMP Blocking Peptide, catalog no. 33R-6605, is also available for use as a blocking control in assays to test for specificity of this LSAMP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSAMP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LSAMP

Target: LSAMP (Limbic System-Associated Membrane Protein (LSAMP))

Alternative Name: LSAMP (LSAMP Products)

Synonyms: chLAMP antibody, IGLON3 antibody, LAMP antibody, 5430428I19 antibody, AW046674 antibody, B130007O04Rik antibody, D930023J12Rik antibody, Lam antibody, Lamp antibody, limbic system-associated membrane protein antibody, LSAMP antibody, Lsamp antibody

Background: LSAMP is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections.

Molecular Weight: 37 kDa (MW of target protein)