Protocadherin 1 antibody (N-Term)
-
- Target See all Protocadherin 1 (PCDH1) Antibodies
- Protocadherin 1 (PCDH1)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Protocadherin 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PCDH1 antibody was raised against the N terminal of PCDH1
- Purification
- Affinity purified
- Immunogen
- PCDH1 antibody was raised using the N terminal of PCDH1 corresponding to a region with amino acids LLPSMLLALLLLLAPSPGHATRVVYKVPEEQPPNTLIGSLAADYGFPDVG
- Top Product
- Discover our top product PCDH1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PCDH1 Blocking Peptide, catalog no. 33R-5177, is also available for use as a blocking control in assays to test for specificity of this PCDH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Protocadherin 1 (PCDH1)
- Alternative Name
- PCDH1 (PCDH1 Products)
- Background
- PCDH1 belongs to the protocadherin subfamily within the cadherin superfamily. It is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity.
- Molecular Weight
- 111 kDa (MW of target protein)
-