Protocadherin 1 antibody (N-Term)

Catalog No. ABIN634688

Product Details anti-Protocadherin 1 Antibody

Target: Protocadherin 1 (PCDH1)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Protocadherin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCDH1 antibody was raised against the N terminal of PCDH1

Purification: Affinity purified

Immunogen: PCDH1 antibody was raised using the N terminal of PCDH1 corresponding to a region with amino acids LLPSMLLALLLLLAPSPGHATRVVYKVPEEQPPNTLIGSLAADYGFPDVG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCDH1 Blocking Peptide, catalog no. 33R-5177, is also available for use as a blocking control in assays to test for specificity of this PCDH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Protocadherin 1

Target: Protocadherin 1 (PCDH1)

Alternative Name: PCDH1 (PCDH1 Products)

Synonyms: PC42 antibody, PCDH42 antibody, 2010005A06Rik antibody, AI585920 antibody, PCDH-1 antibody, axpc antibody, protocadherin-1 antibody, pcdh1 antibody, protocadherin 1 antibody, protocadherin 1 S homeolog antibody, protocadherin 1b antibody, PCDH1 antibody, Pcdh1 antibody, pcdh1.S antibody, pcdh1b antibody

Background: PCDH1 belongs to the protocadherin subfamily within the cadherin superfamily. It is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity.

Molecular Weight: 111 kDa (MW of target protein)