Cx40/GJA5 antibody (N-Term)
-
- Target See all Cx40/GJA5 (GJA5) Antibodies
- Cx40/GJA5 (GJA5) (Gap Junction Protein, alpha 5, 40kDa (GJA5))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Cx40/GJA5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GJA5 antibody was raised against the N terminal of GJA5
- Purification
- Affinity purified
- Immunogen
- GJA5 antibody was raised using the N terminal of GJA5 corresponding to a region with amino acids STPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSC
- Top Product
- Discover our top product GJA5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GJA5 Blocking Peptide, catalog no. 33R-8882, is also available for use as a blocking control in assays to test for specificity of this GJA5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cx40/GJA5 (GJA5) (Gap Junction Protein, alpha 5, 40kDa (GJA5))
- Alternative Name
- GJA5 (GJA5 Products)
- Synonyms
- Cx40 antibody, 5730555N10Rik antibody, Cnx40 antibody, Gja-5 antibody, ATFB11 antibody, CX40 antibody, gap junction protein, alpha 5 antibody, gap junction protein alpha 5 antibody, Gja5 antibody, GJA5 antibody
- Background
- GJA5 belongs to the connexin family, alpha-type subfamily. It is an integral membrane protein that forms transmembrane channels, and may function in small molecule transport, muscle contraction and cell-cell communication. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-