Desmoglein 2 antibody (N-Term)
-
- Target See all Desmoglein 2 (DSG2) Antibodies
- Desmoglein 2 (DSG2)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Desmoglein 2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Desmoglein 2 antibody was raised against the N terminal of DSG2
- Purification
- Affinity purified
- Immunogen
- Desmoglein 2 antibody was raised using the N terminal of DSG2 corresponding to a region with amino acids KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREE
- Top Product
- Discover our top product DSG2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Desmoglein 2 Blocking Peptide, catalog no. 33R-4430, is also available for use as a blocking control in assays to test for specificity of this Desmoglein 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DSG2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Desmoglein 2 (DSG2)
- Alternative Name
- Desmoglein 2 (DSG2 Products)
- Synonyms
- DSG2 antibody, dsc antibody, dsga antibody, si:dkeyp-51f12.6 antibody, wu:fj23f02 antibody, ARVC10 antibody, ARVD10 antibody, CDHF5 antibody, CMD1BB antibody, HDGC antibody, AA408168 antibody, D18Ertd293e antibody, desmoglein 2 antibody, desmoglein 2, tandem duplicate 1 antibody, DSG2 antibody, dsg2.1 antibody, dsg2 antibody, Dsg2 antibody
- Background
- Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. DSG2 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines.
- Molecular Weight
- 114 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-