CD36 antibody
-
- Target See all CD36 Antibodies
- CD36
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CD36 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogen
- CD36 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIA
- Top Product
- Discover our top product CD36 Primary Antibody
-
-
- Application Notes
-
WB: 0.2-1 µg/mL, IHC: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CD36 Blocking Peptide, catalog no. 33R-6013, is also available for use as a blocking control in assays to test for specificity of this CD36 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD36 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CD36
- Alternative Name
- CD36 (CD36 Products)
- Synonyms
- BDPLT10 antibody, CHDS7 antibody, FAT antibody, GP3B antibody, GP4 antibody, GPIV antibody, PASIV antibody, SCARB3 antibody, Fat antibody, Scarb3 antibody, GPIIIB antibody, PAS-4 antibody, zgc:92513 antibody, CD36 molecule antibody, CD36 molecule (thrombospondin receptor) antibody, CD36 antibody, Cd36 antibody, cd36 antibody
- Background
- CD36 is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in its gene cause platelet glycoprotein deficiency.
- Molecular Weight
- 53 kDa (MW of target protein)
- Pathways
- TLR Signaling, Peptide Hormone Metabolism, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Regulation of Lipid Metabolism by PPARalpha, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Hepatitis C, Toll-Like Receptors Cascades, Lipid Metabolism, S100 Proteins
-