Claudin 23 antibody (C-Term)

Catalog No. ABIN634675

Product Details anti-Claudin 23 Antibody

Target: Claudin 23 (CLDN23)

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Claudin 23 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Claudin 23 antibody was raised against the C terminal of CLDN23

Purification: Affinity purified

Immunogen: Claudin 23 antibody was raised using the C terminal of CLDN23 corresponding to a region with amino acids IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE

Application Details

Application Notes: WB: 0.2-0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Claudin 23 Blocking Peptide, catalog no. 33R-4034, is also available for use as a blocking control in assays to test for specificity of this Claudin 23 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Claudin 23

Target: Claudin 23 (CLDN23)

Alternative Name: Claudin 23 (CLDN23 Products)

Synonyms: CLDN23 antibody, CLDNL antibody, hCG1646163 antibody, 2310014B08Rik antibody, claudin 23 antibody, si:ch211-95j8.2 antibody, CLDN23 antibody, si:ch211-95j8.2 antibody, Cldn23 antibody

Background: CLDN23 is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C. It is a candidate tumor suppressor gene implicated in intestinal-type gastric cancer.

Molecular Weight: 17 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C