GJA3 antibody (N-Term)

Catalog No. ABIN634674

Product Details anti-GJA3 Antibody

Target: GJA3 (Gap Junction Protein, alpha 3, 46kDa (GJA3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GJA3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GJA3 antibody was raised against the N terminal of GJA3

Purification: Affinity purified

Immunogen: GJA3 antibody was raised using the N terminal of GJA3 corresponding to a region with amino acids ISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESPS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GJA3 Blocking Peptide, catalog no. 33R-4153, is also available for use as a blocking control in assays to test for specificity of this GJA3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GJA3

Target: GJA3 (Gap Junction Protein, alpha 3, 46kDa (GJA3))

Alternative Name: GJA3 (GJA3 Products)

Background: GJA3 belongs to the connexin family. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in GJA3 are the cause of zonular pulverulent cataract type 3 (CZP3).

Molecular Weight: 47 kDa (MW of target protein)