GJA3 antibody (N-Term)
-
- Target See all GJA3 Antibodies
- GJA3 (Gap Junction Protein, alpha 3, 46kDa (GJA3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GJA3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GJA3 antibody was raised against the N terminal of GJA3
- Purification
- Affinity purified
- Immunogen
- GJA3 antibody was raised using the N terminal of GJA3 corresponding to a region with amino acids ISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESPS
- Top Product
- Discover our top product GJA3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GJA3 Blocking Peptide, catalog no. 33R-4153, is also available for use as a blocking control in assays to test for specificity of this GJA3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GJA3 (Gap Junction Protein, alpha 3, 46kDa (GJA3))
- Alternative Name
- GJA3 (GJA3 Products)
- Synonyms
- cx46 antibody, MGC53082 antibody, czp3 antibody, Cx44 antibody, cx48.5 antibody, Cnx46 antibody, Cx43 antibody, Cx46 antibody, Gja-3 antibody, CTRCT14 antibody, CX46 antibody, CZP3 antibody, MGC69466 protein L homeolog antibody, gap junction protein alpha 3 antibody, gap junction protein, alpha 3 antibody, MGC69466.L antibody, gja3 antibody, GJA3 antibody, Gja3 antibody
- Background
- GJA3 belongs to the connexin family. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in GJA3 are the cause of zonular pulverulent cataract type 3 (CZP3).
- Molecular Weight
- 47 kDa (MW of target protein)
-