Astrotactin 2 antibody (N-Term)

Catalog No. ABIN634672

Product Details anti-Astrotactin 2 Antibody

Target: Astrotactin 2 (ASTN2)

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Astrotactin 2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Astrotactin 2 antibody was raised against the N terminal of ASTN2

Purification: Affinity purified

Immunogen: Astrotactin 2 antibody was raised using the N terminal of ASTN2 corresponding to a region with amino acids PGSAGTAAESRLLLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADIS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Astrotactin 2 Blocking Peptide, catalog no. 33R-7131, is also available for use as a blocking control in assays to test for specificity of this Astrotactin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASTN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Astrotactin 2

Target: Astrotactin 2 (ASTN2)

Alternative Name: Astrotactin 2 (ASTN2 Products)

Synonyms: bA67K19.1 antibody, ASTN2 antibody, 1d8 antibody, Astnl antibody, bM452J22.1 antibody, astrotactin 2 antibody, astrotactin-2 antibody, ASTN2 antibody, LOC702370 antibody, astn2 antibody, Astn2 antibody

Background: ASTN2 may play an important role in neuronal functioning.

Molecular Weight: 142 kDa (MW of target protein)