KIT Ligand antibody (Middle Region)

Catalog No. ABIN634669

Product Details anti-KIT Ligand Antibody

Target: KIT Ligand (KITLG)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIT Ligand antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KITLG antibody was raised against the middle region of KITLG

Purification: Affinity purified

Immunogen: KITLG antibody was raised using the middle region of KITLG corresponding to a region with amino acids TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KITLG Blocking Peptide, catalog no. 33R-9145, is also available for use as a blocking control in assays to test for specificity of this KITLG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KITLG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIT Ligand

Target: KIT Ligand (KITLG)

Alternative Name: KITLG (KITLG Products)

Synonyms: Xkl-1 antibody, Xsl antibody, Xsl-1 antibody, Xsl-2 antibody, steel antibody, KITLG antibody, SCF antibody, kitl antibody, kl-1 antibody, mgf antibody, scf antibody, FPH2 antibody, KL-1 antibody, Kitl antibody, MGF antibody, SF antibody, SHEP7 antibody, Clo antibody, Con antibody, Gb antibody, Kitlg antibody, Mgf antibody, SLF antibody, Sl antibody, blz antibody, contrasted antibody, 710-712 antibody, CSF antibody, KITL antibody, KIT ligand L homeolog antibody, KIT ligand antibody, kit ligand antibody, kitlg.L antibody, KITLG antibody, kitlg antibody, Kitl antibody, Kitlg antibody

Background: KITLG is the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway