Osteopontin antibody

Catalog No. ABIN634668

Product Details anti-Osteopontin Antibody

Target: Osteopontin (SPP1) (Secreted phosphoprotein 1 (SPP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Osteopontin antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SPP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPP1 Blocking Peptide, catalog no. 33R-6363, is also available for use as a blocking control in assays to test for specificity of this SPP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Osteopontin

Target: Osteopontin (SPP1) (Secreted phosphoprotein 1 (SPP1))

Alternative Name: SPP1 (SPP1 Products)

Synonyms: BNSP antibody, BSPI antibody, ETA-1 antibody, OPN antibody, 2AR antibody, Apl-1 antibody, Bsp antibody, Eta antibody, OP antibody, Opn antibody, Opnl antibody, Ric antibody, Spp-1 antibody, OSP antibody, zgc:111821 antibody, secreted phosphoprotein 1 antibody, SPP1 antibody, Spp1 antibody, spp1 antibody

Background: The SPP1 gene encodes an acidic matrix protein, mainly expressed in mineralized tissues, kidney and atherosclerotic vessels. This protein also contributes to several steps in the process of prostate carcinogenesis and metastasis.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Regulation of Cell Size