MICA antibody (N-Term)

Catalog No. ABIN634664

Product Details anti-MICA Antibody

Target: MICA (MHC Class I Polypeptide-Related Sequence A (MICA))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MICA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MICA antibody was raised against the N terminal of MICA

Purification: Affinity purified

Immunogen: MICA antibody was raised using the N terminal of MICA corresponding to a region with amino acids LHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MICA Blocking Peptide, catalog no. 33R-5029, is also available for use as a blocking control in assays to test for specificity of this MICA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MICA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MICA

Target: MICA (MHC Class I Polypeptide-Related Sequence A (MICA))

Alternative Name: MICA (MICA Products)

Synonyms: MIC-A antibody, PERB11.1 antibody, MHC class I polypeptide-related sequence A antibody, MICA antibody

Background: MICA is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognised by intestinal epithelial gamma delta T cells.

Molecular Weight: 43 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Transition Metal Ion Homeostasis, Human Leukocyte Antigen (HLA) in Adaptive Immune Response