SPON2 antibody (N-Term)
-
- Target See all SPON2 Antibodies
- SPON2 (Spondin 2 (SPON2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SPON2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SPON2 antibody was raised against the N terminal of SPON2
- Purification
- Affinity purified
- Immunogen
- SPON2 antibody was raised using the N terminal of SPON2 corresponding to a region with amino acids CSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMW
- Top Product
- Discover our top product SPON2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SPON2 Blocking Peptide, catalog no. 33R-1803, is also available for use as a blocking control in assays to test for specificity of this SPON2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPON2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPON2 (Spondin 2 (SPON2))
- Alternative Name
- SPON2 (SPON2 Products)
- Background
- SPON2 is a cell adhesion protein that promote adhesion and outgrowth of hippocampal embryonic neurons. Binds directly to bacteria and their components and functions as an opsonin for macrophage phagocytosis of bacteria. It is essential in the initiation of the innate immune response and represents a unique pattern-recognition molecule in the ECM for microbial pathogens.
- Molecular Weight
- 36 kDa (MW of target protein)
-