MFAP4 antibody (N-Term)
-
- Target See all MFAP4 Antibodies
- MFAP4 (Microfibrillar-Associated Protein 4 (MFAP4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MFAP4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MFAP4 antibody was raised against the N terminal of MFAP4
- Purification
- Affinity purified
- Immunogen
- MFAP4 antibody was raised using the N terminal of MFAP4 corresponding to a region with amino acids TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK
- Top Product
- Discover our top product MFAP4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MFAP4 Blocking Peptide, catalog no. 33R-9037, is also available for use as a blocking control in assays to test for specificity of this MFAP4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MFAP4 (Microfibrillar-Associated Protein 4 (MFAP4))
- Alternative Name
- MFAP4 (MFAP4 Products)
- Background
- MFAP4 is a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene encoding MFAP4 is located within the Smith-Magenis syndrome region.
- Molecular Weight
- 29 kDa (MW of target protein)
-