SIGLEC6 antibody (N-Term)

Catalog No. ABIN634640

Product Details anti-SIGLEC6 Antibody

Target: SIGLEC6 (Sialic Acid Binding Ig-Like Lectin 6 (SIGLEC6))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SIGLEC6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SIGLEC6 antibody was raised against the N terminal of SIGLEC6

Purification: Affinity purified

Immunogen: SIGLEC6 antibody was raised using the N terminal of SIGLEC6 corresponding to a region with amino acids MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SIGLEC6 Blocking Peptide, catalog no. 33R-6326, is also available for use as a blocking control in assays to test for specificity of this SIGLEC6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SIGLEC6

Target: SIGLEC6 (Sialic Acid Binding Ig-Like Lectin 6 (SIGLEC6))

Alternative Name: SIGLEC6 (SIGLEC6 Products)

Synonyms: SIGLEC6 antibody, CD327 antibody, CD33L antibody, CD33L1 antibody, CD33L2 antibody, CDW327 antibody, OBBP1 antibody, sialic acid binding Ig like lectin 6 antibody, SIGLEC6 antibody

Background: SIGLEC6 is a Putative adhesion molecule that mediates sialic-acid dependent binding to cells. It binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.

Molecular Weight: 36 kDa (MW of target protein)