PNN antibody (N-Term)
-
- Target See all PNN Antibodies
- PNN (Pinin, Desmosome Associated Protein (PNN))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PNN antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PNN antibody was raised against the N terminal of PNN
- Purification
- Affinity purified
- Immunogen
- PNN antibody was raised using the N terminal of PNN corresponding to a region with amino acids MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP
- Top Product
- Discover our top product PNN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PNN Blocking Peptide, catalog no. 33R-5794, is also available for use as a blocking control in assays to test for specificity of this PNN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PNN (Pinin, Desmosome Associated Protein (PNN))
- Alternative Name
- PNN (PNN Products)
- Synonyms
- DRS antibody, DRSP antibody, SDK3 antibody, memA antibody, wu:fb24d03 antibody, pnn antibody, MGC88923 antibody, PNN antibody, AU045199 antibody, D12Ertd512e antibody, CG8383 antibody, Dmel\\CG8383 antibody, dPnn antibody, pinin, desmosome associated protein antibody, pinin antibody, Pinin antibody, PNN antibody, Pnn antibody, pnn antibody, LOC100380709 antibody
- Background
- PNN is the transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene, the core-binding sequence is 5'CAGGTG-3'. PNN is capable of reversing CTBP1-mediated transcription repression.
- Molecular Weight
- 81 kDa (MW of target protein)
-