ANXA8L2 antibody (N-Term)
-
- Target See all ANXA8L2 Antibodies
- ANXA8L2 (Annexin A8-Like 2 (ANXA8L2))
-
Binding Specificity
- N-Term
-
Reactivity
- Chemical
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ANXA8L2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Annexin A8-Like 2 antibody was raised against the N terminal of ANXA8 L2
- Cross-Reactivity
- Human
- Purification
- Affinity purified
- Immunogen
- Annexin A8-Like 2 antibody was raised using the N terminal of ANXA8 L2 corresponding to a region with amino acids PDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTET
- Top Product
- Discover our top product ANXA8L2 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Annexin A8-Like 2 Blocking Peptide, catalog no. 33R-7004, is also available for use as a blocking control in assays to test for specificity of this Annexin A8-Like 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ANXA8L2 (Annexin A8-Like 2 (ANXA8L2))
- Alternative Name
- Annexin A8-Like 2 (ANXA8L2 Products)
- Target Type
- Chemical
- Background
- ANXA8L2 is a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.
- Molecular Weight
- 37 kDa (MW of target protein)
-