ANXA8L2 antibody (Middle Region)

Catalog No. ABIN634617

Product Details anti-ANXA8L2 Antibody

Target: ANXA8L2 (Annexin A8-Like 2 (ANXA8L2))

Binding Specificity: Middle Region

Reactivity: Chemical

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANXA8L2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Annexin A8-Like 2 antibody was raised against the middle region of ANXA8 L2

Cross-Reactivity: Human, Rat (Rattus)

Purification: Affinity purified

Immunogen: Annexin A8-Like 2 antibody was raised using the middle region of ANXA8 L2 corresponding to a region with amino acids VFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Annexin A8-Like 2 Blocking Peptide, catalog no. 33R-9523, is also available for use as a blocking control in assays to test for specificity of this Annexin A8-Like 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANXA8L2

Target: ANXA8L2 (Annexin A8-Like 2 (ANXA8L2))

Alternative Name: Annexin A8-Like 2 (ANXA8L2 Products)

Synonyms: ANXA8 antibody, VAC-beta antibody, annexin A8-like 1 antibody, annexin A8 like 1 antibody, ANXA8L1 antibody

Target Type: Chemical

Background: ANXA8L2 is a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.

Molecular Weight: 37 kDa (MW of target protein)