Annexin a10 antibody (Middle Region)

Catalog No. ABIN634610

Product Details anti-Annexin a10 Antibody

Target: Annexin a10 (ANXA10) (Annexin A10 (ANXA10))

Binding Specificity: Middle Region

Reactivity: Chemical

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Annexin a10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Annexin A10 antibody was raised against the middle region of ANXA10

Cross-Reactivity: Human

Purification: Affinity purified

Immunogen: Annexin A10 antibody was raised using the middle region of ANXA10 corresponding to a region with amino acids VLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Annexin A10 Blocking Peptide, catalog no. 33R-9693, is also available for use as a blocking control in assays to test for specificity of this Annexin A10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Annexin a10

Target: Annexin a10 (ANXA10) (Annexin A10 (ANXA10))

Alternative Name: Annexin A10 (ANXA10 Products)

Synonyms: ANXA10 antibody, ANX14 antibody, RGD1560956 antibody, annexin A10 antibody, ANXA10 antibody, anxa10 antibody, Anxa10 antibody

Target Type: Chemical

Background: This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The function of this gene has not yet been dete

Molecular Weight: 37 kDa (MW of target protein)