Claudin 1 antibody (C-Term)

Catalog No. ABIN634607

Product Details anti-Claudin 1 Antibody

Target: Claudin 1 (CLDN1)

Binding Specificity: C-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Claudin 1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Claudin 1 antibody was raised against the C terminal of CLDN1

Purification: Affinity purified

Immunogen: Claudin 1 antibody was raised using the C terminal of CLDN1 corresponding to a region with amino acids GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV

Application Details

Application Notes: WB: 1-5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Claudin 1 Blocking Peptide, catalog no. 33R-3488, is also available for use as a blocking control in assays to test for specificity of this Claudin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Claudin 1

Target: Claudin 1 (CLDN1)

Alternative Name: Claudin 1 (CLDN1 Products)

Synonyms: CLD1 antibody, ILVASC antibody, SEMP1 antibody, AI596271 antibody, cldn19 antibody, claudin-1 antibody, cld1 antibody, ilvasc antibody, semp1 antibody, CLDN1 antibody, claudin 1 antibody, claudin 1 S homeolog antibody, CLDN1 antibody, Cldn1 antibody, cldn1 antibody, cldn1.S antibody

Background: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. This protein, a member of the claudin family, is an integral membrane protein and a component of tight junction strands.

Molecular Weight: 23 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C