Symplekin antibody (N-Term)
-
- Target See all Symplekin (SYMPK) Antibodies
- Symplekin (SYMPK)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Symplekin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Symplekin antibody was raised against the N terminal of SYMPK
- Purification
- Affinity purified
- Immunogen
- Symplekin antibody was raised using the N terminal of SYMPK corresponding to a region with amino acids RTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLW
- Top Product
- Discover our top product SYMPK Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Symplekin Blocking Peptide, catalog no. 33R-8224, is also available for use as a blocking control in assays to test for specificity of this Symplekin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYMPK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Symplekin (SYMPK)
- Alternative Name
- Symplekin (SYMPK Products)
- Background
- SYMPK is a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex.
- Molecular Weight
- 141 kDa (MW of target protein)
-