Symplekin antibody (N-Term)

Catalog No. ABIN634602

Product Details anti-Symplekin Antibody

Target: Symplekin (SYMPK)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Symplekin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Symplekin antibody was raised against the N terminal of SYMPK

Purification: Affinity purified

Immunogen: Symplekin antibody was raised using the N terminal of SYMPK corresponding to a region with amino acids RTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Symplekin Blocking Peptide, catalog no. 33R-8224, is also available for use as a blocking control in assays to test for specificity of this Symplekin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYMPK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Symplekin

Target: Symplekin (SYMPK)

Alternative Name: Symplekin (SYMPK Products)

Synonyms: SPK antibody, SYM antibody, CG2097 antibody, Dmel\\CG2097 antibody, dSymp antibody, 1500016F02Rik antibody, 4632415H16Rik antibody, AA125406 antibody, AI449890 antibody, Hfn3g antibody, sympk antibody, MGC75595 antibody, SYMPK antibody, T22C5.3 antibody, DKFZp468C0711 antibody, symplekin antibody, Symplekin antibody, symplekin S homeolog antibody, SYMPK antibody, Sym antibody, Sympk antibody, sympk.S antibody, sympk antibody, LOC552752 antibody, AT1G27595 antibody, LOC5580150 antibody, CpipJ_CPIJ011126 antibody, Bm1_50390 antibody, NAEGRDRAFT_80124 antibody, LOAG_00841 antibody

Background: SYMPK is a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex.

Molecular Weight: 141 kDa (MW of target protein)