Symplekin antibody (N-Term)

Catalog No. ABIN634602

Product Details anti-Symplekin Antibody

Target: Symplekin (SYMPK)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Symplekin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Symplekin antibody was raised against the N terminal of SYMPK

Purification: Affinity purified

Immunogen: Symplekin antibody was raised using the N terminal of SYMPK corresponding to a region with amino acids RTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Symplekin Blocking Peptide, catalog no. 33R-8224, is also available for use as a blocking control in assays to test for specificity of this Symplekin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYMPK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Symplekin

Target: Symplekin (SYMPK)

Alternative Name: Symplekin (SYMPK Products)

Background: SYMPK is a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex.

Molecular Weight: 141 kDa (MW of target protein)