PPP1R13B antibody
-
- Target See all PPP1R13B Antibodies
- PPP1R13B (Protein Phosphatase 1, Regulatory Subunit 13B (PPP1R13B))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPP1R13B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PPP1 R11 antibody was raised using a synthetic peptide corresponding to a region with amino acids EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNA
- Top Product
- Discover our top product PPP1R13B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPP1R13B Blocking Peptide, catalog no. 33R-2400, is also available for use as a blocking control in assays to test for specificity of this PPP1R13B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPP1R13B (Protein Phosphatase 1, Regulatory Subunit 13B (PPP1R13B))
- Alternative Name
- PPP1R13B (PPP1R13B Products)
- Background
- PPP1R13B is a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. ASPP proteins are required for the induction of apoptosis by p53-family proteins. They promote DNA binding and transactivation of p53-family proteins on the promoters of proapoptotic genes. Expression of this gene is regulated by the E2F transcription factor.
- Molecular Weight
- 119 kDa (MW of target protein)
- Pathways
- p53 Signaling
-