ELMO3 antibody (Middle Region)
-
- Target See all ELMO3 Antibodies
- ELMO3 (Engulfment and Cell Motility 3 (ELMO3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ELMO3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ELMO3 antibody was raised against the middle region of ELMO3
- Purification
- Affinity purified
- Immunogen
- ELMO3 antibody was raised using the middle region of ELMO3 corresponding to a region with amino acids RKLGFSNSNPAQDLERVPPGLLALDNMLYFSRNAPSAYSRFVLENSSRED
- Top Product
- Discover our top product ELMO3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ELMO3 Blocking Peptide, catalog no. 33R-8001, is also available for use as a blocking control in assays to test for specificity of this ELMO3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELMO3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ELMO3 (Engulfment and Cell Motility 3 (ELMO3))
- Alternative Name
- ELMO3 (ELMO3 Products)
- Synonyms
- TMEM208 antibody, ELMO3 antibody, CED-12 antibody, CED12 antibody, ELMO-3 antibody, 9930107J06 antibody, BC058752 antibody, Ced12 antibody, transmembrane protein 208 antibody, engulfment and cell motility 3 antibody, TMEM208 antibody, ELMO3 antibody, elmo3 antibody, Elmo3 antibody
- Background
- ELMO3 is similar to a C. elegans protein that functions in phagocytosis of apoptotic cells and in cell migration. Other members of this small family of engulfment and cell motility (ELMO) proteins have been shown to interact with the dedicator of cyto-kinesis 1 protein to promote phagocytosis and effect cell shape changes.
- Molecular Weight
- 87 kDa (MW of target protein)
-