SERPINB2 antibody

Catalog No. ABIN634589

Product Details anti-SERPINB2 Antibody

Target: SERPINB2 (Plasminogen Activator Inhibitor 2 (SERPINB2))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SERPINB2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SERPINB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SERPINB2 Blocking Peptide, catalog no. 33R-3366, is also available for use as a blocking control in assays to test for specificity of this SERPINB2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SERPINB2

Target: SERPINB2 (Plasminogen Activator Inhibitor 2 (SERPINB2))

Alternative Name: SERPINB2 (SERPINB2 Products)

Synonyms: HsT1201 antibody, PAI antibody, PAI-2 antibody, PAI2 antibody, PLANH2 antibody, SERPINB2 antibody, Planh2 antibody, ovalbumin antibody, Pai2a antibody, serpin family B member 2 antibody, serpin peptidase inhibitor, clade B (ovalbumin), member 2 antibody, serine (or cysteine) peptidase inhibitor, clade B, member 2 antibody, SERPINB2 antibody, Serpinb2 antibody

Target Type: Amino Acid

Background: SERPINB2 inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Autophagy